A matrix pair of an almost diagonal skew-symmetric matrix and a symmetric positive definite matrix

DOI10.1016/0024-3795(93)90259-QzbMath0790.15020MaRDI QIDQ1316177

Vjeran Hari, Noah H. Rhee

Publication date: 20 June 1994

Published in: Linear Algebra and its Applications (Search for Journal in Brave)

zbMATH Keywords

quadratic convergenceskew-symmetricsymmetric positive definitemultiple eigenvaluesMurnaghan formalmost diagonal matrix pairasymptotic behavior of diagonalization methodsgeneralized skew-symmetric eigenvalues problemPaardekooper method

Mathematics Subject Classification ID

Numerical computation of eigenvalues and eigenvectors of matrices (65F15) Eigenvalues, singular values, and eigenvectors (15A18) Hermitian, skew-Hermitian, and related matrices (15B57)

Related Items

On the cubic convergence of the Paardekooper method

Cites Work

• On sharp quadratic convergence bounds for the serial Jacobi methods
• Almost diagonal matrices with multiple or close eigenvalues
• An eigenvalue algorithm for skew-symmetric matrices
• On pairs of almost diagonal matrices
• The variation of the spectrum of a normal matrix
• A Canonical Form for Real Matrices under Orthogonal Transformations
• On a combined sturm sequence and inverse iteration technique for eigenproblem solution of spinning structures
• Unnamed Item
• Unnamed Item