Constitutive relation errors for F.E. analysis considering (visco‐) plasticity and damage

DOI10.1002/nme.301zbMath1001.74111OpenAlexW1965373282MaRDI QIDQ2763343

Pierre Ladevèze

Publication date: 15 December 2002

Published in: International Journal for Numerical Methods in Engineering (Search for Journal in Brave)

Full work available at URL: https://doi.org/10.1002/nme.301

zbMATH Keywords

finite element methodsofteningadaptivitydamageplasticityviscoplasticityiterative techniquea posteriori error estimatorstime discretizationspace discretizationconstitutive relation residuals

Mathematics Subject Classification ID

Small-strain, rate-dependent theories of plasticity (including theories of viscoplasticity) (74C10) Small-strain, rate-independent theories of plasticity (including rigid-plastic and elasto-plastic materials) (74C05) Anelastic fracture and damage (74R20) Finite element methods applied to problems in solid mechanics (74S05)

Related Items (11)

Constitutive-relation-error-based \textit{a posteriori} error bounds for a class of elliptic variational inequalities ⋮ Modal-based goal-oriented error assessment for timeline-dependent quantities in transient dynamics ⋮ An Introductory Review on A Posteriori Error Estimation in Finite Element Computations ⋮ Error assessment in structural transient dynamics ⋮ Parameter identification and model updating in the context of nonlinear mechanical behaviors using a unified formulation of the modified constitutive relation error concept ⋮ \textit{A posteriori} error estimation for isogeometric analysis using the concept of constitutive relation error ⋮ Locality constraints within multiscale model for non-linear material behaviour ⋮ Strict bounding of quantities of interest in computations based on domain decomposition ⋮ Study of the strong prolongation equation for the construction of statically admissible stress fields: implementation and optimization ⋮ Time finite elements and error computation for (visco)plasticity with hardening or softening ⋮ History of the Finite Element Method – Mathematics Meets Mechanics – Part II: Mathematical Foundation of Primal FEM for Elastic Deformations, Error Analysis and Adaptivity

Cites Work

• Unnamed Item
• Adaptive finite element methods in computational mechanics
• Computational error estimates and adaptive processes for some nonlinear structural problems
• Adaptive finite element methods for a class of evolution problems in viscoplasticity
• New advances on a posteriori error on constitutive relation in f. e. analysis
• A general method for recovering equilibrating element tractions
• A posteriori error estimation in finite element analysis
• A posteriori error estimation in large-strain elasticity using equilibrated local Neumann problems
• A new a posteriori error estimation for nonlinear time-dependent finite element analysis
• A damage computational approach for composites: Basic aspects and micromechanical relations
• Constitutive Relation Error Estimators and Adaptivity in Structural Engineering
• Error Estimate Procedure in the Finite Element Method and Applications
• Validation of a posteriori error estimators by numerical approach
• On error estimates and adaptivity in elastoplastic solids: Applications to the numerical simulation of strain localization in classical and Cosserat continua
• Enhanced superconvergent patch recovery incorporating equilibrium and boundary conditions
• Procedures for residual equilibration and local error estimation in the finite element method
• Arbitrary Lagrangian–Eulerian finite element analysis of strain localization in transient problems
• ERROR ESTIMATION AND ADAPTIVITY IN ELASTOPLASTICITY

This page was built for publication: Constitutive relation errors for F.E. analysis considering (visco‐) plasticity and damage