A simple finite element model for vibration analyses induced by moving vehicles

DOI10.1002/nme.1748zbMath1129.74339OpenAlexW2112506890MaRDI QIDQ5435383

Hung-Ta Lin, Chung-Cheng Hsueh, S. H. Ju, Shin-Lin Wang

Publication date: 14 January 2008

Published in: International Journal for Numerical Methods in Engineering (Search for Journal in Brave)

Full work available at URL: https://doi.org/10.1002/nme.1748

zbMATH Keywords

finite element methoddampingwheelstiffnessmassvehicleroad irregularity

Mathematics Subject Classification ID

Vibrations in dynamical problems in solid mechanics (74H45) Finite element methods applied to problems in solid mechanics (74S05)

Related Items (5)

3D analysis of high-speed trains moving on bridges with foundation settlements ⋮ Dynamic analysis of an inclined Timoshenko beam traveled by successive moving masses/forces with inclusion of geometric nonlinearities ⋮ An adaptive algorithm in time domain for dynamic analysis of a simply supported beam subjected to a moving vehicle ⋮ Nonlinear dynamics of an inclined beam subjected to a moving load ⋮ Dynamic responses of Euler-Bernoulli beam subjected to moving vehicles using isogeometric approach

This page was built for publication: A simple finite element model for vibration analyses induced by moving vehicles